• Gene id: 51510

Gene Summary

• Gene Symbol: CHMP5   Gene   UCSC   Ensembl
• Aliases: C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60
• Gene name: charged multivesicular body protein 5
• Alternate names: charged multivesicular body protein 5, SNF7 domain containing 2, SNF7 domain-containing protein 2, apoptosis-related protein PNAS-2, chromatin-modifying protein 5, hVps60, vacuolar protein sorting-associated protein 60,
• Gene location: 9p13.3 (33264878: 33282069)     Exons: 8     NC_000009.12
• Gene summary(Entrez): CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor pr
• OMIM: 610900

Protein Summary

• Protein general information: Q9NZZ3  
  • Name: Charged multivesicular body protein 5 (Chromatin modifying protein 5) (SNF7 domain containing protein 2) (Vacuolar protein sorting associated protein 60) (Vps60) (hVps60)
  • Length: 219  
  • Mass: 24571
• Sequence:

  MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMY
  EQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALS
  RSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS

• Structural information:
  • Interpro: IPR005024  
  • PDB: 2LXM 3ULY 3UM0 3UM1 3UM2 4TXR
  • PDBsum: 2LXM 3ULY 3UM0 3UM1 3UM2 4TXR
  • DIP: 50420
  • STRING: ENSP00000223500
• Other Databases: GeneCards:  CHMP5  Malacards:  CHMP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904903	ESCRT III complex disassembly	NAS	biological process
GO:0036258	multivesicular body assembly	NAS	biological process
GO:0005771	multivesicular body	IBA	cellular component
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway	IBA	biological process
GO:0006900	vesicle budding from membrane	IBA	biological process
GO:0061952	midbody abscission	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0071225	cellular response to muramyl dipeptide	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007034	vacuolar transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001919	regulation of receptor recycling	IEA	biological process
GO:0008333	endosome to lysosome transport	IEA	biological process
GO:0007040	lysosome organization	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071985	multivesicular body sorting pathway	IMP	biological process
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006997	nucleus organization	IMP	biological process
GO:0046755	viral budding	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010824	regulation of centrosome duplication	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04217	Necroptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881