• Gene id: 5151

Gene Summary

• Gene Symbol: PDE8A   Gene   UCSC   Ensembl
• Aliases: HsT19550
• Gene name: phosphodiesterase 8A
• Alternate names: high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A, cAMP-specific cyclic nucleotide phosphodiesterase 8A,
• Gene location: 15q25.3 (84980466: 85139141)     Exons: 28     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign
• OMIM: 602726

Protein Summary

• Protein general information: O60658  
  • Name: High affinity cAMP specific and IBMX insensitive 3',5' cyclic phosphodiesterase 8A (EC 3.1.4.53)
  • Length: 829  
  • Mass: 93304
  • Tissue specificity: Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
• Sequence:

  MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRF
  HQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFLDKHHDIIIIDHRNPRQLDAEALCRSIRSS
  KLSENTVIVGVVRRVDREELSVMPFISAGFTRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSE
  DAIEITSEDRFIQYANPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
  QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEVSSQ
  RRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLEILRTTELYSPQFGAKDDDPHANDLVGGLMS
  DGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARF
  GICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
  PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFE
  HVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFS
  QTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLR
  PPPE

• Structural information:
  • Protein Domains: (213..28-)
    (/note="PAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00140-)
    (287..32-)
    (/note="PAC-)
    (480..82-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR000014  IPR035965  IPR013767  IPR023088   IPR002073  IPR036971  IPR023174  
  • Prosite: PS50112 PS00126 PS51845
  • CDD: cd00077 cd00130
  • PDB: 1LHQ 1LXX 3ECM 3ECN
  • PDBsum: 1LHQ 1LXX 3ECM 3ECN
  • STRING: ENSP00000311453
• Other Databases: GeneCards:  PDE8A  Malacards:  PDE8A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IBA	biological process
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IEA	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0006198	cAMP catabolic process	IEA	biological process
GO:0047555	3',5'-cyclic-GMP phosphodiesterase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IMP	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	IMP	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa04934	Cushing syndrome
hsa05032	Morphine addiction
hsa04927	Cortisol synthesis and secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq