• Gene id: 51501

Gene Summary

• Gene Symbol: HIKESHI   Gene   UCSC   Ensembl
• Aliases: C11orf73, HLD13, HSPC138, HSPC179, L7RN6, OPI10
• Gene name: heat shock protein nuclear import factor hikeshi
• Alternate names: protein Hikeshi, Hikeshi, heat shock protein nuclear import factor, lethal, Chr 7, Rinchik 6,
• Gene location: 11q14.2 (75480753: 75503862)     Exons: 7     NC_000012.12
• Gene summary(Entrez): This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but n
• OMIM: 614908

Protein Summary

• Protein general information: Q53FT3  
  • Name: Protein Hikeshi
  • Length: 197  
  • Mass: 21628
• Sequence:

  MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTN
  GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFY
  NFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

• Structural information:
  • Interpro: IPR008493  IPR031318  
  • PDB: 3WVZ 3WW0
  • PDBsum: 3WVZ 3WW0
  • STRING: ENSP00000278483
• Other Databases: GeneCards:  HIKESHI  Malacards:  HIKESHI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0030544	Hsp70 protein binding	IBA	molecular function
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0034605	cellular response to heat	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0015031	protein transport	IDA	biological process
GO:0006606	protein import into nucleus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007030	Golgi organization	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0061608	nuclear import signal receptor activity	IDA	molecular function

Diseases

Associated diseases	References
Hypomyelinating leukodystrophy	KEGG:H00679
Hypomyelinating leukodystrophy	KEGG:H00679
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881