• Gene id: 51499

Gene Summary

• Gene Symbol: TRIAP1   Gene   UCSC   Ensembl
• Aliases: HSPC132, MDM35, P53CSV, WF-1
• Gene name: TP53 regulated inhibitor of apoptosis 1
• Alternate names: TP53-regulated inhibitor of apoptosis 1, mitochondrial distribution and morphology 35 homolog, p53-inducible cell-survival factor, protein 15E1.1,
• Gene location: 12q24.31 (120446383: 120443963)     Exons: 2     NC_000012.12
• OMIM: 614943

Protein Summary

• Protein general information: O43715  
  • Name: TP53 regulated inhibitor of apoptosis 1 (Protein 15E1.1) (WF 1) (p53 inducible cell survival factor) (p53CSV)
  • Length: 76  
  • Mass: 8786
• Sequence:

  MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENS
  S

• Structural information:
  • Protein Domains: (5..5-)
    (/note="CHCH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01150"-)
  • Interpro: IPR007918  
  • Prosite: PS51808
  • PDB: 4XZS 4XZV 6I3V 6I3Y 6I4Y
  • PDBsum: 4XZS 4XZV 6I3V 6I3Y 6I4Y
  • STRING: ENSP00000449795
• Other Databases: GeneCards:  TRIAP1  Malacards:  TRIAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990050	phosphatidic acid transfer activity	IDA	contributes to
GO:1990050	phosphatidic acid transfer activity	IDA	contributes to
GO:0032991	protein-containing complex	IDA	cellular component
GO:0015914	phospholipid transport	IDA	biological process
GO:2001140	positive regulation of phospholipid transport	IDA	biological process
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097035	regulation of membrane lipid distribution	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0120009	intermembrane lipid transfer	IEA	biological process
GO:0120009	intermembrane lipid transfer	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)