• Gene id: 51490

Gene Summary

• Gene Symbol: SPOUT1   Gene   UCSC   Ensembl
• Aliases: C9orf114, CENP-32, CENP32, HSPC109
• Gene name: SPOUT domain containing methyltransferase 1
• Alternate names: putative methyltransferase C9orf114, centromere protein 32, kinetochore-associated protein,
• Gene location: 9q34.11 (128833308: 128819650)     Exons: 13     NC_000009.12
• OMIM: 605698

Protein Summary

• Protein general information: Q5T280  
  • Name: Putative methyltransferase C9orf114 (EC 2.1.1. ) (Centromere protein 32) (CENP 32) (Kinetochore associated protein) (SPOUT domain containing methyltransferase 1)
  • Length: 376  
  • Mass: 42009
• Sequence:

  MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTL
  SVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLE
  CPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGL
  RVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQ
  LPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARH
  T

• Structural information:
  • Interpro: IPR029028  IPR012340  IPR003750  IPR029026  
  • PDB: 4RG1
  • PDBsum: 4RG1
  • STRING: ENSP00000354812
• Other Databases: GeneCards:  SPOUT1  Malacards:  SPOUT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051661	maintenance of centrosome location	IBA	biological process
GO:0035198	miRNA binding	IBA	molecular function
GO:0031616	spindle pole centrosome	IBA	cellular component
GO:0000776	kinetochore	IBA	cellular component
GO:0072686	mitotic spindle	IBA	cellular component
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IBA	biological process
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0035198	miRNA binding	IDA	molecular function
GO:0072686	mitotic spindle	IDA	cellular component
GO:0051661	maintenance of centrosome location	IMP	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IMP	biological process
GO:0010608	posttranscriptional regulation of gene expression	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0032259	methylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq