• Gene id: 51458

Gene Summary

• Gene Symbol: RHCG   Gene   UCSC   Ensembl
• Aliases: C15orf6, PDRC2, RHGK, SLC42A3
• Gene name: Rh family C glycoprotein
• Alternate names: ammonium transporter Rh type C, Rh type C glycoprotein, Rhesus blood group, C glycoprotein, rh family type C glycoprotein, rh glycoprotein kidney, rhesus blood group family type C glycoprotein, tumor-related protein DRC2,
• Gene location: 15q26.1 (89496582: 89471406)     Exons: 11     NC_000015.10
• OMIM: 148030

Protein Summary

• Protein general information: Q9UBD6  
  • Name: Ammonium transporter Rh type C (Rh glycoprotein kidney) (Rhesus blood group family type C glycoprotein) (Rh family type C glycoprotein) (Rh type C glycoprotein) (Tumor related protein DRC2)
  • Length: 479  
  • Mass: 53179
  • Tissue specificity: Expressed in brain, testis, placenta, pancreas, esophagus and prostate. Expressed in squamous epithelial tissues (at protein level). According to PubMed
• Sequence:

  MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFG
  FLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVVGVENLINADFCVASVCVAFGAVLGKVSPIQ
  LLIMTFFQVTLFAVNEFILLNLLKVKDAGGSMTIHTFGAYFGLTVTRILYRRNLEQSKERQNSVYQSDLFAMIGT
  LFLWMYWPSFNSAISYHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMM
  LMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGIIGGIVGAVTAASASLEVYGKEGLVHS
  FDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPFWGQPSDENCFEDAVYWEMPEGNSTVYIPED
  PTFKPSGPSVPSVPMVSPLPMASSVPLVP

• Structural information:
  • Interpro: IPR029020  IPR024041  IPR002229  
  • PDB: 3HD6
  • PDBsum: 3HD6
  • DIP: 59334
  • STRING: ENSP00000268122
• Other Databases: GeneCards:  RHCG  Malacards:  RHCG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008519	ammonium transmembrane transporter activity	IBA	molecular function
GO:0072488	ammonium transmembrane transport	IBA	biological process
GO:0008519	ammonium transmembrane transporter activity	IEA	molecular function
GO:0015696	ammonium transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015696	ammonium transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008519	ammonium transmembrane transporter activity	TAS	molecular function
GO:0008519	ammonium transmembrane transporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006885	regulation of pH	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0008519	ammonium transmembrane transporter activity	IEA	molecular function
GO:0015696	ammonium transport	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0015696	ammonium transport	IDA	biological process
GO:0015696	ammonium transport	IDA	biological process
GO:0015696	ammonium transport	IDA	biological process
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070634	transepithelial ammonium transport	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0015696	ammonium transport	IDA	biological process
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0006873	cellular ion homeostasis	IDA	biological process
GO:0030506	ankyrin binding	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	NAS	biological process
GO:0015837	amine transport	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042592	homeostatic process	NAS	biological process
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0008519	ammonium transmembrane transporter activity	IGI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0015696	ammonium transport	IGI	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R