• Gene id: 51454

Gene Summary

• Gene Symbol: GULP1   Gene   UCSC   Ensembl
• Aliases: CED-6, CED6, GULP
• Gene name: GULP PTB domain containing engulfment adaptor 1
• Alternate names: PTB domain-containing engulfment adapter protein 1, GULP, engulfment adaptor PTB domain containing 1, PTB domain adapter protein CED-6, PTB domain adaptor protein CED-6, cell death protein 6 homolog, engulfment adapter protein,
• Gene location: 2q32.1-q32.2 (188291698: 188595925)     Exons: 18     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by R
• OMIM: 608165

Protein Summary

• Protein general information: Q9UBP9  
  • Name: PTB domain containing engulfment adapter protein 1 (Cell death protein 6 homolog) (PTB domain adapter protein CED 6) (Protein GULP)
  • Length: 304  
  • Mass: 34490
  • Tissue specificity: Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary. {ECO
• Sequence:

  MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQIS
  IYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYR
  KFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPKSPSTDIFDMIPFSPI
  SHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
  DSRC

• Structural information:
  • Protein Domains: (21..17-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR011993  IPR006020  
  • Prosite: PS01179
  • PDB: 6ITU
  • PDBsum: 6ITU
  • STRING: ENSP00000386289
• Other Databases: GeneCards:  GULP1  Malacards:  GULP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006909	phagocytosis	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006911	phagocytosis, engulfment	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006911	phagocytosis, engulfment	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881