• Gene id: 51451

Gene Summary

• Gene Symbol: LCMT1   Gene   UCSC   Ensembl
• Aliases: CGI-68, LCMT, PPMT1
• Gene name: leucine carboxyl methyltransferase 1
• Alternate names: leucine carboxyl methyltransferase 1, [Phosphatase 2A protein]-leucine-carboxy methyltransferase 1, protein phosphatase methyltransferase 1, protein-leucine O-methyltransferase,
• Gene location: 16p12.1 (25111701: 25178230)     Exons: 12     NC_000016.10
• Gene summary(Entrez): LCMT1 catalyzes the methylation of the carboxyl group of the C-terminal leucine residue (leu309) of the catalytic subunit of protein phosphatase-2A (PPP2CA; MIM 176915) (De Baere et al., 1999 [PubMed 10600115]).[supplied by OMIM, Mar 2008]
• OMIM: 610286

Protein Summary

• Protein general information: Q9UIC8  
  • Name: Leucine carboxyl methyltransferase 1 (EC 2.1.1.233) (Protein leucine O methyltransferase) ([Phosphatase 2A protein] leucine carboxy methyltransferase 1)
  • Length: 334  
  • Mass: 38379
• Sequence:

  MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVH
  GVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSE
  DTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMF
  INYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLE
  FLDEMELLEQLMRHYCLCWATKGGNELGLKEITY

• Structural information:
  • Interpro: IPR016651  IPR007213  IPR029063  
  • PDB: 3IEI 3O7W 3P71
  • PDBsum: 3IEI 3O7W 3P71
  • STRING: ENSP00000382021
• Other Databases: GeneCards:  LCMT1  Malacards:  LCMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018423	protein C-terminal leucine carboxyl O-methyltransferase activity	IBA	molecular function
GO:0006481	C-terminal protein methylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0032259	methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0003880	protein C-terminal carboxyl O-methyltransferase activity	TAS	molecular function
GO:0008757	S-adenosylmethionine-dependent methyltransferase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006481	C-terminal protein methylation	IDA	biological process
GO:0003880	protein C-terminal carboxyl O-methyltransferase activity	IDA	molecular function
GO:0031333	negative regulation of protein-containing complex assembly	IMP	biological process
GO:0006479	protein methylation	IMP	biological process
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0018423	protein C-terminal leucine carboxyl O-methyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006479	protein methylation	IEA	biological process
GO:0008276	protein methyltransferase activity	IEA	molecular function
GO:0010906	regulation of glucose metabolic process	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)