• Gene id: 51449

Gene Summary

• Gene Symbol: PCYOX1   Gene   UCSC   Ensembl
• Aliases: PCL1
• Gene name: prenylcysteine oxidase 1
• Alternate names: prenylcysteine oxidase 1, prenylcysteine lyase,
• Gene location: 2p13.3 (70258136: 70281184)     Exons: 6     NC_000002.12
• Gene summary(Entrez): Prenylcysteine is released during the degradation of prenylated proteins. PCYOX1 catalyzes the degradation of prenylcysteine to yield free cysteines and a hydrophobic isoprenoid product (Tschantz et al., 1999 [PubMed 10585463]).[supplied by OMIM, Mar 2008
• OMIM: 610995

Protein Summary

• Protein general information: Q9UHG3  
  • Name: Prenylcysteine oxidase 1 (EC 1.8.3.5) (Prenylcysteine lyase)
  • Length: 505  
  • Mass: 56640
  • Tissue specificity: Ubiquitous.
• Sequence:

  MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKDVKIDLFEREEVGGRL
  ATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIYNGETLVFEESNWFIINVIKLVWRYGFQSL
  RMHMWVEDVLDKFMRIYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNY
  GQSTDINAFVGAVSLSCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTKTKYTGNPTKMYEVVYQIG
  TETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSRPIDKFGLNTVLTTDN
  SDLFINSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIIL
  HDRLYYLNGIECAASAMEMSAIAAHNAALLAYHRWNGHTDMIDQDGLYEKLKTEL

• Structural information:
  • Interpro: IPR036188  IPR010795  IPR017046  
  • STRING: ENSP00000387654
• Other Databases: GeneCards:  PCYOX1  Malacards:  PCYOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030327	prenylated protein catabolic process	IBA	biological process
GO:0001735	prenylcysteine oxidase activity	IBA	molecular function
GO:0001735	prenylcysteine oxidase activity	IEA	molecular function
GO:0016670	oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor	IEA	molecular function
GO:0030328	prenylcysteine catabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0001735	prenylcysteine oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0008555	ATPase-coupled chloride transmembrane transporter activity	IEA	molecular function
GO:0001735	prenylcysteine oxidase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0030328	prenylcysteine catabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001735	prenylcysteine oxidase activity	IDA	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0030327	prenylated protein catabolic process	IDA	biological process
GO:0034361	very-low-density lipoprotein particle	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0030327	prenylated protein catabolic process	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00900	Terpenoid backbone biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray