• Gene id: 51447

Gene Summary

• Gene Symbol: IP6K2   Gene   UCSC   Ensembl
• Aliases: IHPK2, InsP6K2, PIUS
• Gene name: inositol hexakisphosphate kinase 2
• Alternate names: inositol hexakisphosphate kinase 2, ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, inositol hexaphosphate kinase 2, insp6 kinase 2, pi uptake stimulator,
• Gene location: 3p21.31 (48717277: 48688002)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,

Protein Summary

• Protein general information: Q9UHH9  
  • Name: Inositol hexakisphosphate kinase 2 (InsP6 kinase 2) (InsP6K2) (EC 2.7.4. ) (P(i) uptake stimulator) (PiUS)
  • Length: 426  
  • Mass: 49186
• Sequence:

  MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFE
  EDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEF
  EWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGT
  RQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR
  RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESADESAGAYAYKPIGAS
  SVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEISEESGE

• Structural information:
  • Interpro: IPR005522  IPR038286  
  • DIP: 29676
  • STRING: ENSP00000331103
• Other Databases: GeneCards:  IP6K2  Malacards:  IP6K2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000828	inositol hexakisphosphate kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0032958	inositol phosphate biosynthetic process	IBA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0016301	kinase activity	IBA	molecular function
GO:0043647	inositol phosphate metabolic process	IDA	biological process
GO:0097243	flavonoid binding	IDA	molecular function
GO:0000832	inositol hexakisphosphate 5-kinase activity	IDA	molecular function
GO:1905396	cellular response to flavonoid	IMP	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006817	phosphate ion transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0046488	phosphatidylinositol metabolic process	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000828	inositol hexakisphosphate kinase activity	IDA	molecular function
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04070	Phosphatidylinositol signaling system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray