• Gene id: 51444

Gene Summary

• Gene Symbol: RNF138   Gene   UCSC   Ensembl
• Aliases: HSD-4, NARF, STRIN, hNARF
• Gene name: ring finger protein 138
• Alternate names: E3 ubiquitin-protein ligase RNF138, NLK-associated RING finger protein, Nemo-like kinase-associated RING finger protein, RING-type E3 ubiquitin transferase RNF138, nemo-like kinase associated ring finger protein, ring finger protein 138, E3 ubiquitin protein l,
• Gene location: 18q12.1 (32091857: 32131560)     Exons: 9     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct i
• OMIM: 616319

Protein Summary

• Protein general information: Q8WVD3  
  • Name: E3 ubiquitin protein ligase RNF138 (EC 2.3.2.27) (Nemo like kinase associated RING finger protein) (NLK associated RING finger protein) (hNARF) (RING finger protein 138) (RING type E3 ubiquitin transferase RNF138)
  • Length: 245  
  • Mass: 28193
• Sequence:

  MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDL
  ENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS
  SSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNL
  QLDEETQYQTAVEESFQVNI

• Structural information:
  • Protein Domains: (225..24-)
    (/note="UIM-)
    (/evidence="ECO:0000305"-)
  • Interpro: IPR008598  IPR034734  IPR001841  IPR013083  
  • Prosite: PS51803 PS50089
  • STRING: ENSP00000261593
• Other Databases: GeneCards:  RNF138  Malacards:  RNF138

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0010792	DNA double-strand break processing involved in repair via single-strand annealing	IBA	biological process
GO:0035861	site of double-strand break	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0035861	site of double-strand break	IDA	cellular component
GO:0010792	DNA double-strand break processing involved in repair via single-strand annealing	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881