• Gene id: 51441

Gene Summary

• Gene Symbol: YTHDF2   Gene   UCSC   Ensembl
• Aliases: CAHL, HGRG8, NY-REN-2
• Gene name: YTH N6-methyladenosine RNA binding protein 2
• Alternate names: YTH domain-containing family protein 2, 9430020E02Rik, CLL-associated antigen KW-14, YTH N(6)-methyladenosine RNA binding protein 2, YTH domain family, member 2, high-glucose-regulated protein 8, renal carcinoma antigen NY-REN-2,
• Gene location: 1p35.3 (28736620: 28769774)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and ma
• OMIM: 610640

Protein Summary

• Protein general information: Q9Y5A9  
  • Name: YTH domain containing family protein 2 (CLL associated antigen KW 14) (High glucose regulated protein 8) (Renal carcinoma antigen NY REN 2)
  • Length: 579  
  • Mass: 62334
• Sequence:

  MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAW
  STGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYS
  SNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNS
  LPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
  QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQ
  AGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMN
  GKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTN
  SRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

• Structural information:
  • Protein Domains: (410..54-)
    (/note="YTH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00225"-)
  • Interpro: IPR007275  
  • Prosite: PS50882
  • PDB: 4RDN 4RDO 4WQN
  • PDBsum: 4RDN 4RDO 4WQN
  • STRING: ENSP00000362918
• Other Databases: GeneCards:  YTHDF2  Malacards:  YTHDF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0061157	mRNA destabilization	IBA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1903679	positive regulation of cap-independent translational initiation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0061157	mRNA destabilization	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0061157	mRNA destabilization	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0061157	mRNA destabilization	IDA	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:1903538	regulation of meiotic cell cycle process involved in oocyte maturation	ISS	biological process
GO:0001556	oocyte maturation	ISS	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	ISS	biological process
GO:0098508	endothelial to hematopoietic transition	ISS	biological process
GO:0045746	negative regulation of Notch signaling pathway	ISS	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	ISS	biological process
GO:0071425	hematopoietic stem cell proliferation	ISS	biological process
GO:0061157	mRNA destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050767	regulation of neurogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IEA	molecular function
GO:1903538	regulation of meiotic cell cycle process involved in oocyte maturation	IEA	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	IEA	biological process
GO:0071425	hematopoietic stem cell proliferation	IEA	biological process
GO:0001556	oocyte maturation	IEA	biological process
GO:0061157	mRNA destabilization	IEA	biological process
GO:0050767	regulation of neurogenesis	IEA	biological process
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)