• Gene id: 5144

Gene Summary

• Gene Symbol: PDE4D   Gene   UCSC   Ensembl
• Aliases: ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
• Gene name: phosphodiesterase 4D
• Alternate names: cAMP-specific 3',5'-cyclic phosphodiesterase 4D, cAMP-specific phosphodiesterase PDE4D6, phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila), testicular tissue protein Li 136,
• Gene location: 5q11.2-q12.1 (60524328: 58969037)     Exons: 39     NC_000005.10
• Gene summary(Entrez): This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses
• OMIM: 600129

Protein Summary

• Protein general information: Q08499  
  • Name: cAMP specific 3',5' cyclic phosphodiesterase 4D (EC 3.1.4.53) (DPDE3) (PDE43)
  • Length: 809  
  • Mass: 91115
  • Tissue specificity: Expressed in colonic epithelial cells (at protein level). Widespread; most abundant in skeletal muscle. Isoform 6 is detected in brain. Isoform 8 is detected in brain, placenta, lung and kidney. Isoform 7 is detected in heart and skele
• Sequence:

  MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPPPPPSPQPQPQCPLQP
  PPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRAMDRTSYAVETGHRPGLKKSRMSWPSSFQGL
  RRFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTP
  FAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
  SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSS
  LTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMT
  LEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMY
  NDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
  LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFI
  DYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEK
  DSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT

• Structural information:
  • Protein Domains: (386..71-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR040844  IPR023088  IPR002073  IPR036971   IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1E9K 1MKD 1OYN 1PTW 1Q9M 1TB7 1TBB 1XOM 1XON 1XOQ 1XOR 1Y2B 1Y2C 1Y2D 1Y2E 1Y2K 1ZKN 2FM0 2FM5 2PW3 2QYN 3G4G 3G4I 3G4K 3G4L 3G58 3IAD 3IAK 3K4S 3SL3 3SL4 3SL5 3SL6 3SL8 3V9B 4OGB 4W1O 4WCU 5K1I 5K32 5LBO 5TKB 5WH5 5WH6 5WQA 6BOJ 6F6U 6F8R 6F8T 6F8U 6F8V 6F8W 6F8X 6FDC 6FDI 6FE7 6FEB 6FET 6FT0 6FTA 6FTW 6FW3 6HWO 6IA
  • PDBsum: 1E9K 1MKD 1OYN 1PTW 1Q9M 1TB7 1TBB 1XOM 1XON 1XOQ 1XOR 1Y2B 1Y2C 1Y2D 1Y2E 1Y2K 1ZKN 2FM0 2FM5 2PW3 2QYN 3G4G 3G4I 3G4K 3G4L 3G58 3IAD 3IAK 3K4S 3SL3 3SL4 3SL5 3SL6 3SL8 3V9B 4OGB 4W1O 4WCU 5K1I 5K32 5LBO 5TKB 5WH5 5WH6 5WQA 6BOJ 6F6U 6F8R 6F8T 6F8U 6F8V 6F8W 6F8X 6FDC 6FDI 6FE7 6FEB 6FET 6FT0 6FTA 6FTW 6FW3 6HWO 6IA
  • DIP: 41115
  • STRING: ENSP00000345502
• Other Databases: GeneCards:  PDE4D  Malacards:  PDE4D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0005813	centrosome	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006198	cAMP catabolic process	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0043951	negative regulation of cAMP-mediated signaling	IBA	biological process
GO:0051117	ATPase binding	IBA	molecular function
GO:0086004	regulation of cardiac muscle cell contraction	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901898	negative regulation of relaxation of cardiac muscle	IEA	biological process
GO:0071872	cellular response to epinephrine stimulus	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050900	leukocyte migration	IEA	biological process
GO:0045822	negative regulation of heart contraction	IEA	biological process
GO:0044325	ion channel binding	IEA	molecular function
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0006939	smooth muscle contraction	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IEA	molecular function
GO:0086004	regulation of cardiac muscle cell contraction	IEA	biological process
GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity	IEA	biological process
GO:0051117	ATPase binding	IEA	molecular function
GO:0035264	multicellular organism growth	IEA	biological process
GO:0034704	calcium channel complex	IEA	cellular component
GO:0005891	voltage-gated calcium channel complex	IEA	cellular component
GO:0002027	regulation of heart rate	IEA	biological process
GO:0030552	cAMP binding	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IGI	molecular function
GO:0044325	ion channel binding	ISS	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0008144	drug binding	IPI	molecular function
GO:0019899	enzyme binding	ISS	molecular function
GO:0031698	beta-2 adrenergic receptor binding	ISS	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0034704	calcium channel complex	IDA	cellular component
GO:0086024	adenylate cyclase-activating adrenergic receptor signaling pathway involved in positive regulation of heart rate	IC	biological process
GO:1901844	regulation of cell communication by electrical coupling involved in cardiac conduction	IC	biological process
GO:0010469	regulation of signaling receptor activity	ISS	biological process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	ISS	biological process
GO:0019933	cAMP-mediated signaling	NAS	biological process
GO:0032743	positive regulation of interleukin-2 production	IMP	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0045822	negative regulation of heart contraction	ISS	biological process
GO:0071875	adrenergic receptor signaling pathway	ISS	biological process
GO:1901898	negative regulation of relaxation of cardiac muscle	ISS	biological process
GO:0002027	regulation of heart rate	ISS	biological process
GO:0005891	voltage-gated calcium channel complex	ISS	cellular component
GO:0032729	positive regulation of interferon-gamma production	IMP	biological process
GO:0032754	positive regulation of interleukin-5 production	IMP	biological process
GO:0050852	T cell receptor signaling pathway	IMP	biological process
GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity	ISS	biological process
GO:0086004	regulation of cardiac muscle cell contraction	ISS	biological process
GO:0086004	regulation of cardiac muscle cell contraction	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006198	cAMP catabolic process	IEA	biological process
GO:0030552	cAMP binding	IDA	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	NAS	molecular function
GO:0061028	establishment of endothelial barrier	ISS	biological process
GO:0008144	drug binding	IPI	molecular function
GO:0043951	negative regulation of cAMP-mediated signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04024	cAMP signaling pathway
hsa00230	Purine metabolism
hsa05032	Morphine addiction
hsa04928	Parathyroid hormone synthesis, secretion and action

Diseases

Associated diseases	References
Acrodysostosis	KEGG:H02211
Acrodysostosis	KEGG:H02211
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq