• Gene id: 51438

Gene Summary

• Gene Symbol: MAGEC2   Gene   UCSC   Ensembl
• Aliases: CT10, HCA587, MAGEE1
• Gene name: MAGE family member C2
• Alternate names: melanoma-associated antigen C2, MAGE-C2 antigen, MAGE-E1 antigen, cancer/testis antigen 10, hepatocellular cancer antigen 587, hepatocellular carcinoma-associated antigen 587, melanoma antigen family C, 2, melanoma antigen family C2, melanoma antigen, family E, 1,
• Gene location: Xq27.2 (142205289: 142202341)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefS
• OMIM: 300468

Protein Summary

• Protein general information: Q9UBF1  
  • Name: Melanoma associated antigen C2 (Cancer/testis antigen 10) (CT10) (Hepatocellular carcinoma associated antigen 587) (MAGE C2 antigen) (MAGE E1 antigen)
  • Length: 373  
  • Mass: 41163
  • Tissue specificity: Not expressed in normal tissues, except in germ cells in the seminiferous tubules and in Purkinje cells of the cerebellum. Expressed in various tumors, including melanoma, lymphoma, as well as pancreatic cancer, mammary gland cancer, n
• Sequence:

  MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEEVPSGV
  IPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVE
  FLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFANTVGLTDEGSDDEGMP
  ENSLLIIILSVIFIKGNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQGHYLEYREVPHSSPPYYEFL
  WGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDTADDATVMASESLSVMSSNVSFSE

• Structural information:
  • Protein Domains: (141..33-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR041898  IPR041899  IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000354660
• Other Databases: GeneCards:  MAGEC2  Malacards:  MAGEC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0051443	positive regulation of ubiquitin-protein transferase activity	IMP	biological process
GO:0044257	cellular protein catabolic process	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881