• Gene id: 51435

Gene Summary

• Gene Symbol: SCARA3   Gene   UCSC   Ensembl
• Aliases: APC7, CSR, CSR1, MSLR1, MSRL1
• Gene name: scavenger receptor class A member 3
• Alternate names: scavenger receptor class A member 3, cellular stress response gene protein, cellular stress response protein, macrophage scavenger receptor-like 1,
• Gene location: 8p21.1 (27633664: 27736593)     Exons: 11     NC_000008.11
• Gene summary(Entrez): This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative
• OMIM: 604696

Protein Summary

• Protein general information: Q6AZY7  
  • Name: Scavenger receptor class A member 3 (Cellular stress response gene protein)
  • Length: 606  
  • Mass: 65137
  • Tissue specificity: Expressed ubiquitously. {ECO
• Sequence:

  MKVRSAGGDGDALCVTEEDLAGDDEDMPTFPCTQKGRPGPRCSRCQKNLSLHTSVRILYLFLALLLVAVAVLASL
  VFRKVDSLSEDISLTQSIYDKKLVLMQKNLQGLDPKALNNCSFCHEAGQLGPEIRKLQEELEGIQKLLLAQEVQL
  DQTLQAQEVLSTTSRQISQEMGSCSFSIHQVNQSLGLFLAQVRGWQATTAGLDLSLKDLTQECYDVKAAVHQINF
  TVGQTSEWIHGIQRKTDEETLTLQKIVTDWQNYTRLFSGLRTTSTKTGEAVKNIQATLGASSQRISQNSESMHDL
  VLQVMGLQLQLDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSML
  KYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRERFSLLSARLDLNVRNLSMIVEEMKAVDTQHGEILR
  NVTILRGAPGPPGPRGFKGDMGVKGPVGGRGPKGDPGSLGPLGPQGPQGQPGEAGPVGERGPVGPRGFPGLKGSK
  GSFGTGGPRGQPGPKGDIGPPGPEGPPGSPGPSGPQGKPGIAGKTGSPGQRGAMGPKGEPGIQGPPGLPGPPGPP
  GSQSFY

• Structural information:
  • Protein Domains: (455..51-)
    (/note="Collagen-like-1)
    (544..60-)
    (/note="Collagen-like-2")
  • Interpro: IPR008160  
  • STRING: ENSP00000301904
• Other Databases: GeneCards:  SCARA3  Malacards:  SCARA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0003429	growth plate cartilage chondrocyte morphogenesis	IBA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0006979	response to oxidative stress	TAS	biological process
GO:0009650	UV protection	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0034138	toll-like receptor 3 signaling pathway	IMP	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq