• Gene id: 51429

Gene Summary

• Gene Symbol: SNX9   Gene   UCSC   Ensembl
• Aliases: SDP1, SH3PX1, SH3PXD3A, WISP
• Gene name: sorting nexin 9
• Alternate names: sorting nexin-9, SH3 and PX domain-containing protein 1, SH3 and PX domain-containing protein 3A, Wiskott-Aldrich syndrome protein (WASP) interactor protein,
• Gene location: 6q25.3 (157716045: 157945076)     Exons: 2     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phosphoinositide binding domain, and are involved in intracellular trafficking. The encoded protein does not contain a coiled coil region, like some family members, b
• OMIM: 605952

Protein Summary

• Protein general information: Q9Y5X1  
  • Name: Sorting nexin 9 (SH3 and PX domain containing protein 1) (Protein SDP1) (SH3 and PX domain containing protein 3A)
  • Length: 595  
  • Mass: 66592
  • Tissue specificity: Widely expressed, with highest levels in heart and placenta, and lowest levels in thymus and peripheral blood leukocytes. {ECO
• Sequence:

  MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
  DQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGH
  PQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQL
  AKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVK
  FGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELA
  GVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFS
  SSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVA
  TSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM

• Structural information:
  • Protein Domains: (1..6-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (250..36-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (392..59-)
    (/note="BAR"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR036028  IPR001452   IPR028644  IPR037425  IPR014536  IPR037426  IPR035558  IPR019497  
  • Prosite: PS50195 PS50002
  • CDD: cd07668 cd07285 cd11898
  • PDB: 2RAI 2RAJ 2RAK 3DYT 3DYU 3LGE
  • PDBsum: 2RAI 2RAJ 2RAK 3DYT 3DYU 3LGE
  • DIP: 30997
  • STRING: ENSP00000376024
• Other Databases: GeneCards:  SNX9  Malacards:  SNX9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030659	cytoplasmic vesicle membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0060988	lipid tube assembly	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0030136	clathrin-coated vesicle	IDA	colocalizes with
GO:0005545	1-phosphatidylinositol binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0036089	cleavage furrow formation	IMP	biological process
GO:0016197	endosomal transport	IMP	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0006886	intracellular protein transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0032437	cuticular plate	ISS	colocalizes with
GO:0030838	positive regulation of actin filament polymerization	ISS	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0032437	cuticular plate	IEA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0071933	Arp2/3 complex binding	IDA	molecular function
GO:0097320	plasma membrane tubulation	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray