• Gene id: 5141

Gene Summary

• Gene Symbol: PDE4A   Gene   UCSC   Ensembl
• Aliases: DPDE2, PDE4, PDE46
• Gene name: phosphodiesterase 4A
• Alternate names: cAMP-specific 3',5'-cyclic phosphodiesterase 4A, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4,
• Gene location: 19p13.2 (10416772: 10469630)     Exons: 22     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign
• OMIM: 600126

Protein Summary

• Protein general information: P27815  
  • Name: cAMP specific 3',5' cyclic phosphodiesterase 4A (EC 3.1.4.53) (DPDE2) (PDE46)
  • Length: 886  
  • Mass: 98143
  • Tissue specificity: Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchia
• Sequence:

  MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQPHRPIERADAMDTSD
  RPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATSQRRESFLYRS
  DSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEE
  TCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
  PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEELLAQELENLNKW
  GLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLA
  TPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNL
  SKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
  LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDN
  RDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEISMAQIPCTAQEALTAQGLSGVEEALDATI
  AWEASPAQESLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWR
  TLSVSEHAPGLPGLPSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT

• Structural information:
  • Protein Domains: (357..68-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR040844  IPR023088  IPR002073  IPR036971   IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 2QYK 3I8V 3TVX
  • PDBsum: 2QYK 3I8V 3TVX
  • STRING: ENSP00000370078
• Other Databases: GeneCards:  PDE4A  Malacards:  PDE4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0035690	cellular response to drug	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0010738	regulation of protein kinase A signaling	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0043949	regulation of cAMP-mediated signaling	IEA	biological process
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IGI	molecular function
GO:0030552	cAMP binding	IGI	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006198	cAMP catabolic process	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04024	cAMP signaling pathway
hsa00230	Purine metabolism
hsa05032	Morphine addiction
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa01100	Metabolic pathways
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04024	cAMP signaling pathway
hsa05032	Morphine addiction
hsa00230	Purine metabolism

Diseases

Associated diseases	References
Associated with spermatogenesis	MIK: 8641200
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq