• Gene id: 51400

Gene Summary

• Gene Symbol: PPME1   Gene   UCSC   Ensembl
• Aliases: ABDH19, PME-1
• Gene name: protein phosphatase methylesterase 1
• Alternate names: protein phosphatase methylesterase 1, testicular secretory protein Li 39,
• Gene location: 11q13.4 (74171089: 74254702)     Exons: 15     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein phosphatase methylesterase localized to the nucleus. The encoded protein acts on the protein phosphatase-2A catalytic subunit and supports the ERK pathway through dephosphorylation of regulatory proteins. It plays a role in mal
• OMIM: 611117

Protein Summary

• Protein general information: Q9Y570  
  • Name: Protein phosphatase methylesterase 1 (PME 1) (EC 3.1.1.89)
  • Length: 386  
  • Mass: 42315
• Sequence:

  MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSE
  GPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPI
  MLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLE
  SARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
  WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEP
  IGGFQCVFPGC

• Structural information:
  • Interpro: IPR029058  IPR000073  IPR016812  
  • Prosite: PS00120
  • PDB: 3C5V 3C5W
  • PDBsum: 3C5V 3C5W
  • STRING: ENSP00000381461
• Other Databases: GeneCards:  PPME1  Malacards:  PPME1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051722	protein C-terminal methylesterase activity	IDA	molecular function
GO:0006482	protein demethylation	IDA	biological process
GO:0051721	protein phosphatase 2A binding	IDA	molecular function
GO:0019903	protein phosphatase binding	IDA	molecular function
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0006482	protein demethylation	IBA	biological process
GO:0051723	protein methylesterase activity	IBA	molecular function
GO:0051723	protein methylesterase activity	IEA	molecular function
GO:0006482	protein demethylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	TAS	molecular function
GO:0006482	protein demethylation	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0051722	protein C-terminal methylesterase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray