• Gene id: 51399

Gene Summary

• Gene Symbol: TRAPPC4   Gene   UCSC   Ensembl
• Aliases: CGI-104, HSPC172, NEDESBA, PTD009, SBDN, SYNBINDIN, TRS23
• Gene name: trafficking protein particle complex 4
• Alternate names: trafficking protein particle complex subunit 4, TRS23 homolog, hematopoietic stem/progenitor cell protein 172,
• Gene location: 11q23.3 (119018765: 119024133)     Exons: 5     NC_000011.10
• OMIM: 131290

Protein Summary

• Protein general information: Q9Y296  
  • Name: Trafficking protein particle complex subunit 4 (Hematopoietic stem/progenitor cell protein 172) (Synbindin) (TRS23 homolog)
  • Length: 219  
  • Mass: 24340
• Sequence:

  MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRY
  TADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTL
  TGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS

• Structural information:
  • Interpro: IPR011012  IPR007233  
  • PDB: 2J3T 2JSN 2ZMV
  • PDBsum: 2J3T 2JSN 2ZMV
  • DIP: 37871
  • STRING: ENSP00000436005
• Other Databases: GeneCards:  TRAPPC4  Malacards:  TRAPPC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030008	TRAPP complex	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0030008	TRAPP complex	IMP	cellular component
GO:0006914	autophagy	IMP	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0030008	TRAPP complex	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030008	TRAPP complex	IEA	cellular component
GO:0016358	dendrite development	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005795	Golgi stack	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030008	TRAPP complex	IDA	cellular component
GO:0005795	Golgi stack	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0016358	dendrite development	ISS	biological process
GO:0008021	synaptic vesicle	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881