• Gene id: 51398

Gene Summary

• Gene Symbol: WDR83OS   Gene   UCSC   Ensembl
• Aliases: ASTERIX, C19orf56, PTD008
• Gene name: WD repeat domain 83 opposite strand
• Alternate names: protein Asterix, UPF0139 membrane protein C19orf56, WDR83 opposite strand,
• Gene location: 19p13.13 (12671022: 12668070)     Exons: 5     NC_000019.10
• OMIM: 618474

Protein Summary

• Protein general information: Q9Y284  
  • Name: Protein Asterix (WD repeat domain 83 opposite strand) (WDR83 opposite strand)
  • Length: 106  
  • Mass: 12068
• Sequence:

  MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSE
  DTKQMMSSFMLSISAVVMSYLQNPQPMTPPW

• Structural information:
  • Interpro: IPR005351  
  • STRING: ENSP00000468969
• Other Databases: GeneCards:  WDR83OS  Malacards:  WDR83OS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq