• Gene id: 51390

Gene Summary

• Gene Symbol: AIG1   Gene   UCSC   Ensembl
• Aliases: AIG-1, dJ95L4.1
• Gene name: androgen induced 1
• Alternate names: androgen-induced gene 1 protein, FAHFA hydrolase AIG1, fatty acid esters of hydroxy fatty acids hydrolase AIG1,
• Gene location: 6q24.2 (143059362: 143343882)     Exons: 17     NC_000006.12
• OMIM: 608514

Protein Summary

• Protein general information: Q9NVV5  
  • Name: Androgen induced gene 1 protein (AIG 1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1. . )
  • Length: 245  
  • Mass: 28222
  • Tissue specificity: Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AI
• Sequence:

  MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQ
  ERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHH
  QYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQ
  KKPPSWQDMKIKFMYLGPSS

• Structural information:
  • Interpro: IPR006838  
  • STRING: ENSP00000350509
• Other Databases: GeneCards:  AIG1  Malacards:  AIG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0042758	long-chain fatty acid catabolic process	IMP	biological process
GO:0016787	hydrolase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray