• Gene id: 51389

Gene Summary

• Gene Symbol: RWDD1   Gene   UCSC   Ensembl
• Aliases: CGI-24, PTD013
• Gene name: RWD domain containing 1
• Alternate names: RWD domain-containing protein 1, DRG family-regulatory protein 2,
• Gene location: 6q22.1 (154870280: 154697454)     Exons: 11     NC_000001.11

Protein Summary

• Protein general information: Q9H446  
  • Name: RWD domain containing protein 1 (DRG family regulatory protein 2)
  • Length: 243  
  • Mass: 27940
• Sequence:

  MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENL
  EDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIEN
  FLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELED
  DEDDPDYNPADPESDSAD

• Structural information:
  • Protein Domains: (10..11-)
    (/note="RWD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00179"-)
  • Interpro: IPR040213  IPR006575  IPR016135  IPR032378  
  • Prosite: PS50908
  • PDB: 2EBM
  • PDBsum: 2EBM
  • DIP: 34520
  • STRING: ENSP00000420357
• Other Databases: GeneCards:  RWDD1  Malacards:  RWDD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0005844	polysome	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000825	positive regulation of androgen receptor activity	IEA	biological process
GO:0071394	cellular response to testosterone stimulus	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0030521	androgen receptor signaling pathway	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)