• Gene id: 51384

Gene Summary

• Gene Symbol: WNT16   Gene   UCSC   Ensembl
• Gene name: Wnt family member 16
• Alternate names: protein Wnt-16, wingless-type MMTV integration site family member 16b, wingless-type MMTV integration site family, member 16,
• Gene location: 7q31.31 (121325366: 121341103)     Exons: 5     NC_000007.14
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Protein Summary

• Protein general information: Q9UBV4  
  • Name: Protein Wnt 16
  • Length: 365  
  • Mass: 40690
  • Tissue specificity: Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.
• Sequence:

  MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSIREGAR
  LGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCD
  TTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHG
  VSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
  GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK

• Structural information:
  • Interpro: IPR005817  IPR013304  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000222462
• Other Databases: GeneCards:  WNT16  Malacards:  WNT16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0060317	cardiac epithelial to mesenchymal transition	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0003408	optic cup formation involved in camera-type eye development	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0043616	keratinocyte proliferation	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0090399	replicative senescence	IMP	biological process
GO:0090403	oxidative stress-induced premature senescence	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030216	keratinocyte differentiation	IMP	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa05202	Transcriptional misregulation in cancer
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray