• Gene id: 5138

Gene Summary

• Gene Symbol: PDE2A   Gene   UCSC   Ensembl
• Aliases: CGS-PDE, PDE2A1, PED2A4, cGSPDE
• Gene name: phosphodiesterase 2A
• Alternate names: cGMP-dependent 3',5'-cyclic phosphodiesterase, cGMP-stimulated phosphodiesterase 1, cGMP-stimulated phosphodiesterase 2, cGMP-stimulated phosphodiesterase 4, cyclic GMP-stimulated phosphodiesterase, phosphodiesterase 2A, cGMP-stimulated,
• Gene location: 11q13.4 (72674421: 72576139)     Exons: 35     NC_000011.10
• OMIM: 604688

Protein Summary

• Protein general information: O00408  
  • Name: cGMP dependent 3',5' cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP stimulated phosphodiesterase) (CGS PDE) (cGSPDE)
  • Length: 941  
  • Mass: 105717
  • Tissue specificity: Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
• Sequence:

  MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAVKEALSAVL
  PRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPGKPLARLVAPLAPDTQVLVMPL
  ADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTD
  RDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
  EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTST
  VLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVV
  DDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKIN
  GPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
  ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNL
  ELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFS
  RKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAEL
  IYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
  KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE

• Structural information:
  • Protein Domains: (241..37-)
    (/note="GAF-1)
    (/evidence="ECO:0000255-)
    (409..54-)
    (/note="GAF-2)
    (/evidence="ECO:0000255-)
    (578..90-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003018  IPR029016  IPR003607  IPR023088  IPR002073   IPR036971  IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1Z1L 3IBJ 3ITM 3ITU 4C1I 4D08 4D09 4HTX 4HTZ 4JIB 5TZ3 5TZA 5TZC 5TZH 5TZW 5TZX 5TZZ 5U00 5U7D 5U7I 5U7J 5U7K 5U7L 5VP0 5VP1 5XKM 6B96 6B97 6B98 6BLF 6C7D 6C7E 6C7F 6C7G 6C7I 6C7J 6CYB 6CYC 6CYD
  • PDBsum: 1Z1L 3IBJ 3ITM 3ITU 4C1I 4D08 4D09 4HTX 4HTZ 4JIB 5TZ3 5TZA 5TZC 5TZH 5TZW 5TZX 5TZZ 5U00 5U7D 5U7I 5U7J 5U7K 5U7L 5VP0 5VP1 5XKM 6B96 6B97 6B98 6BLF 6C7D 6C7E 6C7F 6C7G 6C7I 6C7J 6CYB 6CYC 6CYD
  • DIP: 40269
  • STRING: ENSP00000334910
• Other Databases: GeneCards:  PDE2A  Malacards:  PDE2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0047555	3',5'-cyclic-GMP phosphodiesterase activity	IBA	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0019934	cGMP-mediated signaling	IBA	biological process
GO:0019933	cAMP-mediated signaling	IBA	biological process
GO:0010821	regulation of mitochondrion organization	IBA	biological process
GO:0010754	negative regulation of cGMP-mediated signaling	IBA	biological process
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004118	cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	IBA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0046069	cGMP catabolic process	IBA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IBA	biological process
GO:0005886	plasma membrane	IBA	colocalizes with
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0030553	cGMP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004118	cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	TAS	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003170	heart valve development	ISS	biological process
GO:0003281	ventricular septum development	ISS	biological process
GO:0035904	aorta development	ISS	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004118	cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	IDA	molecular function
GO:0004118	cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0071321	cellular response to cGMP	IDA	biological process
GO:0030553	cGMP binding	IDA	molecular function
GO:0030553	cGMP binding	IDA	molecular function
GO:0030553	cGMP binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0071321	cellular response to cGMP	IDA	biological process
GO:0046069	cGMP catabolic process	IDA	biological process
GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0047555	3',5'-cyclic-GMP phosphodiesterase activity	IDA	molecular function
GO:0042301	phosphate ion binding	IDA	molecular function
GO:1904613	cellular response to 2,3,7,8-tetrachlorodibenzodioxine	IDA	biological process
GO:0071320	cellular response to cAMP	IDA	biological process
GO:0030552	cAMP binding	IMP	molecular function
GO:0008144	drug binding	IPI	molecular function
GO:0043951	negative regulation of cAMP-mediated signaling	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0043117	positive regulation of vascular permeability	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042734	presynaptic membrane	ISS	cellular component
GO:0035690	cellular response to drug	IMP	biological process
GO:0030911	TPR domain binding	IPI	molecular function
GO:0019934	cGMP-mediated signaling	IMP	biological process
GO:0019933	cAMP-mediated signaling	IMP	biological process
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0071260	cellular response to mechanical stimulus	ISS	biological process
GO:0030553	cGMP binding	IMP	molecular function
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process
GO:0061028	establishment of endothelial barrier	ISS	biological process
GO:0043116	negative regulation of vascular permeability	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04022	cGMP-PKG signaling pathway
hsa00230	Purine metabolism
hsa04740	Olfactory transduction
hsa05032	Morphine addiction
hsa04925	Aldosterone synthesis and secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray