• Gene id: 51379

Gene Summary

• Gene Symbol: CRLF3   Gene   UCSC   Ensembl
• Aliases: CREME-9, CREME9, CRLM9, CYTOR4, FRWS, p48.2
• Gene name: cytokine receptor like factor 3
• Alternate names: cytokine receptor-like factor 3, cytokine receptor-like molecule 9, cytokine receptor-related protein 4, type I cytokine receptor-like factor p48,
• Gene location: 17q11.2 (30824759: 30782683)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a cytokine receptor-like factor that may negatively regulate cell cycle progression at the G0/G1 phase. Studies of the related rat protein suggest that it may regulate neuronal morphology and synaptic vesicle biogenesis. This gene is one
• OMIM: 614853

Protein Summary

• Protein general information: Q8IUI8  
  • Name: Cytokine receptor like factor 3 (Cytokine receptor like molecule 9) (CREME 9) (Cytokine receptor related protein 4) (Type I cytokine receptor like factor p48)
  • Length: 442  
  • Mass: 49766
  • Tissue specificity: Expressed in several embryonic and adult tissues, including adult and fetal brain, liver, spleen and pancreas. Expressed in adult, but not fetal kidney. Expressed in skin and squamous cell carcinoma (SCC) and in several other cancer ty
• Sequence:

  MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQTRDVLKQHFNDLKGTLGKLLDERLV
  TLLQEVDTIEQETIKPLDDCQKLIEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLV
  DVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFED
  VYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSES
  SGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQAVCISTNGAVFVNGKEMTNQLPAVT
  SGSTVTFDIEAVTLGTTSNNEGGHFKLRVTISSNNREVVFDWLLDQSCGSLYFGCSFFYPGWKVLVF

• Structural information:
  • Protein Domains: (181..27-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • STRING: ENSP00000318804
• Other Databases: GeneCards:  CRLF3  Malacards:  CRLF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071158	positive regulation of cell cycle arrest	IDA	biological process
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R