• Gene id: 51377

Gene Summary

• Gene Symbol: UCHL5   Gene   UCSC   Ensembl
• Aliases: CGI-70, INO80R, UCH-L5, UCH37
• Gene name: ubiquitin C-terminal hydrolase L5
• Alternate names: ubiquitin carboxyl-terminal hydrolase isozyme L5, INO80 complex subunit R, ubiquitin C-terminal hydrolase UCH37, ubiquitin carboxyl-terminal esterase L5, ubiquitin carboxyl-terminal hydrolase L5, ubiquitin thioesterase L5,
• Gene location: 1q31.2 (193060139: 193012253)     Exons: 17     NC_000001.11

Protein Summary

• Protein general information: Q9Y5K5  
  • Name: Ubiquitin carboxyl terminal hydrolase isozyme L5 (UCH L5) (EC 3.4.19.12) (Ubiquitin C terminal hydrolase UCH37) (Ubiquitin thioesterase L5)
  • Length: 329  
  • Mass: 37607
• Sequence:

  MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLD
  TIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFE
  FDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVS
  DRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
  KTLAEHQQLIPLVEKAKEKQNAKKAQETK

• Structural information:
  • Interpro: IPR038765  IPR001578  IPR036959  IPR017390  IPR033837   IPR041507  
  • CDD: cd02255
  • PDB: 3A7S 3IHR 3RII 3RIS 3TB3 4UEL 4UEM 4UF5 4UF6 4WLP
  • PDBsum: 3A7S 3IHR 3RII 3RIS 3TB3 4UEL 4UEM 4UF5 4UF6 4WLP
  • DIP: 42671
  • STRING: ENSP00000356425
• Other Databases: GeneCards:  UCHL5  Malacards:  UCHL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016579	protein deubiquitination	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0070628	proteasome binding	IDA	molecular function
GO:0070628	proteasome binding	IDA	molecular function
GO:0031011	Ino80 complex	IDA	cellular component
GO:0031011	Ino80 complex	IDA	colocalizes with
GO:0016579	protein deubiquitination	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004866	endopeptidase inhibitor activity	IMP	molecular function
GO:0061136	regulation of proteasomal protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016579	protein deubiquitination	IEA	biological process
GO:0031011	Ino80 complex	IEA	cellular component
GO:0070628	proteasome binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000502	proteasome complex	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0016579	protein deubiquitination	IMP	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IMP	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881