• Gene id: 51374

Gene Summary

• Gene Symbol: ATRAID   Gene   UCSC   Ensembl
• Aliases: APR--3, APR-3, APR3, C2orf28, HSPC013, PRO240, p18
• Gene name: all-trans retinoic acid induced differentiation factor
• Alternate names: all-trans retinoic acid-induced differentiation factor, apoptosis related protein APR-3, apoptosis-related protein 3,
• Gene location: 2p23.3 (96493600: 96611789)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. The use of alternative splice sites and promotors result in multiple transcript variants encoding different isoforms.[provided by

Protein Summary

• Protein general information: Q6UW56  
  • Name: All trans retinoic acid induced differentiation factor (Apoptosis related protein 3) (APR 3) (p18)
  • Length: 229  
  • Mass: 24747
  • Tissue specificity: Weakly expressed in hematopoietic cell lines. {ECO
• Sequence:

  MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGL
  DLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQ
  GQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRK
  AKTS

• Structural information:
  • Protein Domains: (152..19-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR042350  IPR013032  IPR000742  
  • Prosite: PS00022 PS01186 PS50026
  • STRING: ENSP00000484228
• Other Databases: GeneCards:  ATRAID  Malacards:  ATRAID

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0033689	negative regulation of osteoblast proliferation	IDA	biological process
GO:0030501	positive regulation of bone mineralization	IDA	biological process
GO:1903363	negative regulation of cellular protein catabolic process	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)