• Gene id: 51373

Gene Summary

• Gene Symbol: MRPS17   Gene   UCSC   Ensembl
• Aliases: HSPC011, MRP-S17, RPMS17, S17mt
• Gene name: mitochondrial ribosomal protein S17
• Alternate names: 28S ribosomal protein S17, mitochondrial, mitochondrial small ribosomal subunit protein uS17m,
• Gene location: 7p11.2 (55951876: 55956499)     Exons: 3     NC_000007.14
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611980

Protein Summary

• Protein general information: Q9Y2R5  
  • Name: 28S ribosomal protein S17, mitochondrial (MRP S17) (S17mt) (Mitochondrial small ribosomal subunit protein uS17m)
  • Length: 130  
  • Mass: 14502
• Sequence:

  MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAK
  HVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ

• Structural information:
  • Interpro: IPR012340  IPR000266  IPR039193  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000285298
• Other Databases: GeneCards:  MRPS17  Malacards:  MRPS17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0019843	rRNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006412	translation	NAS	biological process
GO:0005763	mitochondrial small ribosomal subunit	NAS	cellular component
GO:0005763	mitochondrial small ribosomal subunit	HDA	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0003735	structural constituent of ribosome	HDA	molecular function
GO:0032543	mitochondrial translation	HDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray