• Gene id: 51347

Gene Summary

• Gene Symbol: TAOK3   Gene   UCSC   Ensembl
• Aliases: DPK, JIK, MAP3K18, hKFC-A
• Gene name: TAO kinase 3
• Alternate names: serine/threonine-protein kinase TAO3, CTCL-associated antigen HD-CL-09, JNK/SAPK-inhibitory kinase, STE20-like kinase, cutaneous T-cell lymphoma-associated antigen HD-CL-09, dendritic cell-derived protein kinase, jun kinase-inhibitory kinase, kinase from chicken,
• Gene location: 12q24.23 (118372949: 118149800)     Exons: 26     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a serine/threonine protein kinase that activates the p38/MAPK14 stress-activated MAPK cascade but inhibits the basal activity of the MAPK8/JNK cascade. The encoded protein is a member of the GCK subfamily of STE20-like
• OMIM: 616711

Protein Summary

• Protein general information: Q9H2K8  
  • Name: Serine/threonine protein kinase TAO3 (EC 2.7.11.1) (Cutaneous T cell lymphoma associated antigen HD CL 09) (CTCL associated antigen HD CL 09) (Dendritic cell derived protein kinase) (JNK/SAPK inhibitory kinase) (Jun kinase inhibitory kinase) (Kinase from
  • Length: 898  
  • Mass: 105406
  • Tissue specificity: Ubiquitously expressed at a low level, and highly expressed in peripheral blood leukocytes (PBLs), thymus, spleen, kidney, skeletal muscle, heart and liver. {ECO
• Sequence:

  MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDILKEVKF
  LRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHSHALIHRDIKA
  GNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMN
  AMSALYHIAQNDSPTLQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAVREL
  DNLQYRKMKKILFQETRNGPLNESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQSSSVNSMQEVMDESS
  SELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYRNRERFATIKSASLVTRQIHE
  HEQENELREQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKV
  AAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHL
  LTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLI
  RLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH
  KTILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHE
  RELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR

• Structural information:
  • Protein Domains: (24..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 6BDN
  • PDBsum: 6BDN
  • STRING: ENSP00000376317
• Other Databases: GeneCards:  TAOK3  Malacards:  TAOK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IDA	biological process
GO:0016740	transferase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0004709	MAP kinase kinase kinase activity	IBA	molecular function
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000186	activation of MAPKK activity	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IMP	biological process
GO:0043507	positive regulation of JUN kinase activity	IMP	biological process
GO:0006468	protein phosphorylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881