• Gene id: 51341

Gene Summary

• Gene Symbol: ZBTB7A   Gene   UCSC   Ensembl
• Aliases: FBI-1, FBI1, LRF, TIP21, ZBTB7, ZNF857A, pokemon
• Gene name: zinc finger and BTB domain containing 7A
• Alternate names: zinc finger and BTB domain-containing protein 7A, HIV-1 1st-binding protein 1, HIV-1 inducer of short transcripts binding protein, POK erythroid myeloid ontogenic factor, POZ and Krueppel erythroid myeloid ontogenic factor, TTF-I-interacting peptide 21, factor ,
• Gene location: 19p13.3 (4066898: 4043302)     Exons: 6     NC_000019.10
• OMIM: 618616

Protein Summary

• Protein general information: O95365  
  • Name: Zinc finger and BTB domain containing protein 7A (Factor binding IST protein 1) (FBI 1) (Factor that binds to inducer of short transcripts protein 1) (HIV 1 1st binding protein 1) (Leukemia/lymphoma related factor) (POZ and Krueppel erythroid myeloid onto
  • Length: 584  
  • Mass: 61439
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVY
  EIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQID
  QRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPP
  AERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
  AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAHDGDVYPAWSQKVEKK
  IRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHN
  YDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPS
  SPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA

• Structural information:
  • Protein Domains: (34..10-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR000210  IPR011333  IPR036236  IPR013087  
  • Prosite: PS50097 PS00028 PS50157
  • PDB: 2IF5 2NN2
  • PDBsum: 2IF5 2NN2
  • DIP: 56307
  • STRING: ENSP00000323670
• Other Databases: GeneCards:  ZBTB7A  Malacards:  ZBTB7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0016581	NuRD complex	IDA	colocalizes with
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0050681	androgen receptor binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0046332	SMAD binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001222	transcription corepressor binding	IDA	molecular function
GO:2000677	regulation of transcription regulatory region DNA binding	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0034504	protein localization to nucleus	IMP	biological process
GO:0006110	regulation of glycolytic process	IMP	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0045746	negative regulation of Notch signaling pathway	ISS	biological process
GO:0043249	erythrocyte maturation	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0006325	chromatin organization	ISS	biological process
GO:0045444	fat cell differentiation	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0060766	negative regulation of androgen receptor signaling pathway	IMP	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0043249	erythrocyte maturation	IMP	biological process
GO:0006338	chromatin remodeling	IMP	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070418	DNA-dependent protein kinase complex	IMP	colocalizes with
GO:0070418	DNA-dependent protein kinase complex	ISS	colocalizes with
GO:0035861	site of double-strand break	ISS	colocalizes with
GO:0097680	double-strand break repair via classical nonhomologous end joining	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001222	transcription corepressor binding	IPI	molecular function
GO:0001222	transcription corepressor binding	IPI	molecular function
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051090	regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043249	erythrocyte maturation	IEA	biological process
GO:0035035	histone acetyltransferase binding	IEA	molecular function
GO:0030183	B cell differentiation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0097680	double-strand break repair via classical nonhomologous end joining	IEA	biological process
GO:0070418	DNA-dependent protein kinase complex	IEA	cellular component
GO:0035861	site of double-strand break	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IMP	biological process
GO:0035035	histone acetyltransferase binding	ISS	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R