Male Infertility Database

Search Result

Gene id

51340

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

CRNKL1 Gene UCSC Ensembl

Aliases

CLF, CRN, Clf1, HCRN, MSTP021, SYF3

Gene name

crooked neck pre-mRNA splicing factor 1

Alternate names

crooked neck-like protein 1, Crn, crooked neck-like 1, SYF3 pre-mRNA-splicing factor, crooked neck homolog, crooked neck pre-mRNA splicing factor-like 1, crooked neck-like 1,

Gene location

20p11.23 (20056045: 20034360) Exons: 16 NC_000020.11

Gene summary(Entrez)

The crooked neck (crn) gene of Drosophila is essential for embryogenesis and is thought to be involved in cell cycle progression and pre-mRNA splicing. A protein encoded by this human locus has been found to localize to pre-mRNA splicing complexes in the

Protein Summary

Protein general information

Q9BZJ0

Name: Crooked neck like protein 1 (Crooked neck homolog) (hCrn)

Length: 848 Mass: 100452

Tissue specificity: Widely expressed (PubMed

Sequence

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHG
VTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVP
GTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKL
RKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWD
RAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPD
VKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQE
LFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQ
EKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSI
GKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMP
EVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEE
RLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLW
KKQQQEKEDAEHHPDEDVDESES

Structural information

Interpro:	IPR003107 IPR013026 IPR011990
PDB:	5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
PDBsum:	5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
MINT:
STRING:	ENSP00000366557

Other Databases

GeneCards: CRNKL1 Malacards: CRNKL1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0071014	post-mRNA release spliceo somal complex	IBA	cellular component
GO:0071013	catalytic step 2 spliceos ome	IBA	cellular component
GO:0000974	Prp19 complex	IBA	cellular component
GO:0000398	mRNA splicing, via splice osome	IBA	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IBA	cellular component
GO:0000245	spliceosomal complex asse mbly	IBA	biological process
GO:0000398	mRNA splicing, via splice osome	IDA	biological process
GO:0071013	catalytic step 2 spliceos ome	IDA	cellular component
GO:0000398	mRNA splicing, via splice osome	IC	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006396	RNA processing	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0000398	mRNA splicing, via splice osome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0000245	spliceosomal complex asse mbly	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Expand All | Collapse All

Associated diseases	References
basal cell carcinoma	PMID:23774526
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25753583	Unexplaine d infertil ity			46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All