• Gene id: 5134

Gene Summary

• Gene Symbol: PDCD2   Gene   UCSC   Ensembl
• Aliases: RP8, ZMYND7
• Gene name: programmed cell death 2
• Alternate names: programmed cell death protein 2, zinc finger MYND domain-containing protein 7, zinc finger protein Rp-8,
• Gene location: 6q27 (170584691: 170575294)     Exons: 8     NC_000006.12
• Gene summary(Entrez): This gene encodes a nuclear protein expressed in a variety of tissues. Expression of this gene has been shown to be repressed by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor required for lymph node germinal center development, suggesting that
• OMIM: 600866

Protein Summary

• Protein general information: Q16342  
  • Name: Programmed cell death protein 2 (Zinc finger MYND domain containing protein 7) (Zinc finger protein Rp 8)
  • Length: 344  
  • Mass: 38592
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPGRPDAF
  HRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGCLGPKTCSRCH
  KAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEE
  ELDSMAKHESREDKIFQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
  LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP

• Structural information:
  • Interpro: IPR007320  IPR002893  
  • Prosite: PS01360 PS50865
  • DIP: 27594
  • STRING: ENSP00000439467
• Other Databases: GeneCards:  PDCD2  Malacards:  PDCD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012501	programmed cell death	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:1902035	positive regulation of hematopoietic stem cell proliferation	IMP	biological process
GO:1901532	regulation of hematopoietic progenitor cell differentiation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881