• Gene id: 51339

Gene Summary

• Gene Symbol: DACT1   Gene   UCSC   Ensembl
• Aliases: DAPPER, DAPPER1, DPR1, FRODO, HDPR1, TBS2, THYEX3
• Gene name: dishevelled binding antagonist of beta catenin 1
• Alternate names: dapper homolog 1, dapper antagonist of catenin 1, dapper, antagonist of beta-catenin, homolog 1, hepatocellular carcinoma novel gene 3 protein, heptacellular carcinoma novel gene 3,
• Gene location: 14q23.1 (58634060: 58648320)     Exons: 7     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this

Protein Summary

• Protein general information: Q9NYF0  
  • Name: Dapper homolog 1 (hDPR1) (Dapper antagonist of catenin 1) (Hepatocellular carcinoma novel gene 3 protein)
  • Length: 836  
  • Mass: 90174
• Sequence:

  MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEYLRQRQELLVRGALRG
  AGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRRRDAGLLNQLQELDKQISDLRLDVEKTSEEH
  LETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCE
  DQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQSPMFLLCLTGNPLREEDRLGN
  HASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKTHPVRTNKPRTSVNADPTKGLLRNGS
  VCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWSKESKAEQAESKRVPLPEGCPSGAASDLQSK
  HLPKTAKPASQEHARCSAIGTGESPKESAQLSGASPKESPSRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPL
  LSTAFPVEERPALDFKSEGSSQSLEEAHLVKAQFIPGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPT
  VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTD
  YRRWKSSAEISYEEALRRARRGRRENVGLYPAPVPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYT
  TNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRF
  RSGSLKLMTTV

• Structural information:
  • Interpro: IPR024848  IPR024843  
  • STRING: ENSP00000337439
• Other Databases: GeneCards:  DACT1  Malacards:  DACT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903364	positive regulation of cellular protein catabolic process	IDA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:1904864	negative regulation of beta-catenin-TCF complex assembly	IDA	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:1903364	positive regulation of cellular protein catabolic process	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0021915	neural tube development	IMP	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IGI	biological process
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IGI	biological process
GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0046329	negative regulation of JNK cascade	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IDA	biological process
GO:1900107	regulation of nodal signaling pathway	IDA	NOT|biological process
GO:0051018	protein kinase A binding	IDA	molecular function
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0030877	beta-catenin destruction complex	IDA	colocalizes with
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005080	protein kinase C binding	ISS	molecular function
GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway	ISS	biological process
GO:0070097	delta-catenin binding	ISS	molecular function
GO:0048619	embryonic hindgut morphogenesis	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IGI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1903364	positive regulation of cellular protein catabolic process	IDA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:1904864	negative regulation of beta-catenin-TCF complex assembly	IDA	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:1903364	positive regulation of cellular protein catabolic process	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0021915	neural tube development	IMP	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IGI	biological process
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IGI	biological process
GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0046329	negative regulation of JNK cascade	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IDA	biological process
GO:1900107	regulation of nodal signaling pathway	IDA	NOT|biological process
GO:0051018	protein kinase A binding	IDA	molecular function
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0030877	beta-catenin destruction complex	IDA	colocalizes with
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005080	protein kinase C binding	ISS	molecular function
GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway	ISS	biological process
GO:0070097	delta-catenin binding	ISS	molecular function
GO:0048619	embryonic hindgut morphogenesis	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IGI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881