• Gene id: 51335

Gene Summary

• Gene Symbol: NGRN   Gene   UCSC   Ensembl
• Aliases: DSC92
• Gene name: neugrin, neurite outgrowth associated
• Alternate names: neugrin, mesenchymal stem cell protein DSC92, neurite outgrowth associated protein, spinal cord-derived protein FI58G,
• Gene location: 15q26.1 (90265662: 90272210)     Exons: 2     NC_000015.10
• OMIM: 300487

Protein Summary

• Protein general information: Q9NPE2  
  • Name: Neugrin (Mesenchymal stem cell protein DSC92) (Neurite outgrowth associated protein) (Spinal cord derived protein FI58G)
  • Length: 291  
  • Mass: 32408
  • Tissue specificity: Expressed at high levels in heart, brain and skeletal muscle. In brain, mainly expressed in neurons rather than glial cells. {ECO
• Sequence:

  MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIRRQMEA
  PGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSL
  QHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVA
  APLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI

• Structural information:
  • Interpro: IPR010487  
  • STRING: ENSP00000368389
• Other Databases: GeneCards:  NGRN  Malacards:  NGRN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0019843	rRNA binding	IDA	molecular function
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0070131	positive regulation of mitochondrial translation	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0030182	neuron differentiation	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray