• Gene id: 51330

Gene Summary

• Gene Symbol: TNFRSF12A   Gene   UCSC   Ensembl
• Aliases: CD266, FN14, TWEAKR
• Gene name: TNF receptor superfamily member 12A
• Alternate names: tumor necrosis factor receptor superfamily member 12A, FGF-inducible 14, fibroblast growth factor-inducible immediate-early response protein 14, tweak-receptor, type I transmembrane protein Fn14,
• Gene location: 16p13.3 (3020367: 3022382)     Exons: 4     NC_000016.10
• OMIM: 606101

Protein Summary

• Protein general information: Q9NP84  
  • Name: Tumor necrosis factor receptor superfamily member 12A (Fibroblast growth factor inducible immediate early response protein 14) (FGF inducible 14) (Tweak receptor) (TweakR) (CD antigen CD266)
  • Length: 129  
  • Mass: 13911
  • Tissue specificity: Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
• Sequence:

  MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPF
  RLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

• Structural information:
  • Interpro: IPR022316  
  • CDD: cd13413
  • PDB: 2EQP 2KMZ 2RPJ
  • PDBsum: 2EQP 2KMZ 2RPJ
  • STRING: ENSP00000326737
• Other Databases: GeneCards:  TNFRSF12A  Malacards:  TNFRSF12A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0006931	substrate-dependent cell migration, cell attachment to substrate	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0061041	regulation of wound healing	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0006931	substrate-dependent cell migration, cell attachment to substrate	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0061041	regulation of wound healing	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq