• Gene id: 51316

Gene Summary

• Gene Symbol: PLAC8   Gene   UCSC   Ensembl
• Aliases: C15, DGIC, PNAS-144, onzin
• Gene name: placenta associated 8
• Alternate names: placenta-specific gene 8 protein, down-regulated in gastrointestinal cancer protein, placenta specific 8,
• Gene location: 4q21.22 (159726695: 159756318)     Exons: 13     NC_000006.12
• OMIM: 607515

Protein Summary

• Protein general information: Q9NZF1  
  • Name: Placenta specific gene 8 protein (Protein C15)
  • Length: 115  
  • Mass: 12507
  • Tissue specificity: Expressed at high levels in plasmacytoid dendritic cells. High expression in spleen, lymph nodes, peripheral blood leukocytes, and bone marrow, with lower expression in thymus, appendix, and fetal liver.
• Sequence:

  MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYR
  TRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

• Structural information:
  • Interpro: IPR006461  
  • STRING: ENSP00000399700
• Other Databases: GeneCards:  PLAC8  Malacards:  PLAC8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0040015	negative regulation of multicellular organism growth	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881