• Gene id: 51312

Gene Summary

• Gene Symbol: SLC25A37   Gene   UCSC   Ensembl
• Aliases: HT015, MFRN, MFRN1, MSC, MSCP, PRO1278, PRO1584, PRO2217
• Gene name: solute carrier family 25 member 37
• Alternate names: mitoferrin-1, mitochondrial iron transporter 1, mitochondrial solute carrier protein, mitoferrin, predicted protein of HQ2217, solute carrier family 25 (mitochondrial iron transporter), member 37,
• Gene location: 8p21.2 (23528955: 23575462)     Exons: 2     NC_000008.11
• Gene summary(Entrez): SLC25A37 is a solute carrier localized in the mitochondrial inner membrane. It functions as an essential iron importer for the synthesis of mitochondrial heme and iron-sulfur clusters (summary by Chen et al., 2009 [PubMed 19805291]).[supplied by OMIM, Jan
• OMIM: 610387

Protein Summary

• Protein general information: Q9NYZ2  
  • Name: Mitoferrin 1 (Mitochondrial iron transporter 1) (Mitochondrial solute carrier protein) (Solute carrier family 25 member 37)
  • Length: 338  
  • Mass: 37323
• Sequence:

  MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVKTRMQS
  LSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQGNSHLANGIAG
  SMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQ
  VNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK
  GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000429200
• Other Databases: GeneCards:  SLC25A37  Malacards:  SLC25A37

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005381	iron ion transmembrane transporter activity	IBA	molecular function
GO:0048250	iron import into the mitochondrion	IBA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0048250	iron import into the mitochondrion	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005381	iron ion transmembrane transporter activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray