• Gene id: 51310

Gene Summary

• Gene Symbol: SLC22A17   Gene   UCSC   Ensembl
• Aliases: 24p3R, BOCT, BOIT, NGALR, NGALR2, NGALR3, hBOIT
• Gene name: solute carrier family 22 member 17
• Alternate names: solute carrier family 22 member 17, 24p3 receptor, NGAL receptor, brain-type organic cation transporter, lipocalin-2 receptor, neutrophil gelatinase-associated lipocalin receptor, potent brain type organic ion transporter, solute carrier family 22 (organic catio,
• Gene location: 14q11.2 (23354990: 23346303)     Exons: 10     NC_000014.9
• OMIM: 609839

Protein Summary

• Protein general information: Q8WUG5  
  • Name: Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain type organic cation transporter) (Lipocalin 2 receptor) (Neutrophil gelatinase associated lipocalin receptor) (NgalR)
  • Length: 538  
  • Mass: 57686
  • Tissue specificity: Expressed in brain.
• Sequence:

  MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASRVATSTDPSCSGFAPPDFNHCLKDWD
  YNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLLTLGLVGPCGVGGAAAGS
  STGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGHFLFLGLALVSKDWRFLQRMITAPCI
  LFLFYGWPGLFLESARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
  YRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSMTLT
  GIASLVLLGLWDCEHPIFPTVWAQQGNPNRDLNEAAITTFSVLGLFSSQAAAILSTLLAAEVIPTTVRGRGLGLI
  MALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSIMLLPETKRKLLPEVLRDGELCRRPSLLRQPPPTRC
  DHVPLLATPNPAL

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR005829  
  • Prosite: PS50850 PS00216
  • STRING: ENSP00000380437
• Other Databases: GeneCards:  SLC22A17  Malacards:  SLC22A17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031301	integral component of organelle membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0015891	siderophore transport	ISS	biological process
GO:0004888	transmembrane signaling receptor activity	ISS	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005773	vacuole	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0022857	transmembrane transporter activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0015891	siderophore transport	IEA	biological process
GO:0005774	vacuolar membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031301	integral component of organelle membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0015891	siderophore transport	ISS	biological process
GO:0004888	transmembrane signaling receptor activity	ISS	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005773	vacuole	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0022857	transmembrane transporter activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0015891	siderophore transport	IEA	biological process
GO:0005774	vacuolar membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq