• Gene id: 51304

Gene Summary

• Gene Symbol: ZDHHC3   Gene   UCSC   Ensembl
• Aliases: DHHC-3, DHHC3, GODZ, ZNF373
• Gene name: zinc finger DHHC-type palmitoyltransferase 3
• Alternate names: palmitoyltransferase ZDHHC3, DHHC1 protein, Golgi apparatus-specific protein with DHHC zinc finger domain, golgi-specific DHHC Zinc Finger Protein, zinc finger DHHC domain-containing protein 3, zinc finger DHHC-type containing 3, zinc finger protein 373, zinc fi,
• Gene location: 3p21.31 (44976181: 44915260)     Exons: 14     NC_000003.12
• OMIM: 617150

Protein Summary

• Protein general information: Q9NYG2  
  • Name: Palmitoyltransferase ZDHHC3 (EC 2.3.1.225) (Protein DHHC1) (Zinc finger DHHC domain containing protein 3) (DHHC 3)
  • Length: 299  
  • Mass: 34170
  • Tissue specificity: Widely expressed with significant expression in heart, lung, liver, skeletal muscle, kidney, testis, thymus, small intestine and leukocyte. {ECO
• Sequence:

  MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVY
  SIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCI
  RKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGL
  LFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV

• Structural information:
  • Protein Domains: (127..17-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000296127
• Other Databases: GeneCards:  ZDHHC3  Malacards:  ZDHHC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0036462	TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0019706	protein-cysteine S-palmitoyltransferase activity	ISS	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	ISS	biological process
GO:0018345	protein palmitoylation	IMP	biological process
GO:0044873	lipoprotein localization to membrane	IMP	biological process
GO:1902685	positive regulation of receptor localization to synapse	ISS	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	ISS	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:1903546	protein localization to photoreceptor outer segment	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881