• Gene id: 51303

Gene Summary

• Gene Symbol: FKBP11   Gene   UCSC   Ensembl
• Aliases: FKBP19
• Gene name: FKBP prolyl isomerase 11
• Alternate names: peptidyl-prolyl cis-trans isomerase FKBP11, 19 kDa FK506-binding protein, 19 kDa FKBP, FK506 binding protein 11, 19 kDa, FK506-binding protein 11, FKBP-11, FKBP-19, PPIase FKBP11, rotamase,
• Gene location: 12q13.12 (48925546: 48921962)     Exons: 8     NC_000012.12
• Gene summary(Entrez): FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rap
• OMIM: 610571

Protein Summary

• Protein general information: Q9NYL4  
  • Name: Peptidyl prolyl cis trans isomerase FKBP11 (PPIase FKBP11) (EC 5.2.1.8) (19 kDa FK506 binding protein) (19 kDa FKBP) (FKBP 19) (FK506 binding protein 11) (FKBP 11) (Rotamase)
  • Length: 201  
  • Mass: 22180
• Sequence:

  MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIID
  TSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWL
  KLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

• Structural information:
  • Protein Domains: (57..14-)
    (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277"-)
  • Interpro: IPR001179  
  • Prosite: PS50059
  • STRING: ENSP00000449751
• Other Databases: GeneCards:  FKBP11  Malacards:  FKBP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)