About Us

Search Result


Gene id 51300
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol TIMMDC1   Gene   UCSC   Ensembl
Aliases C3orf1, MC1DN31
Gene name translocase of inner mitochondrial membrane domain containing 1
Alternate names complex I assembly factor TIMMDC1, mitochondrial, M5-14 protein, TIMM domain containing-protein 1, translocase of inner mitochondrial membrane domain-containing protein 1, transmembrane protein C3orf1,
Gene location 3q13.33 (119498524: 119525089)     Exons: 7     NC_000003.12
OMIM 615534

Protein Summary

Protein general information Q9NPL8  

Name: Complex I assembly factor TIMMDC1, mitochondrial (Protein M5 14) (Translocase of inner mitochondrial membrane domain containing protein 1) (TIMM domain containing protein 1)

Length: 285  Mass: 32178

Tissue specificity: Generalized expression enhanced in heart and skeletal muscle. {ECO

Sequence MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLA
NICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFN
TVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDR
KALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Structural information
MINT:  
STRING:   ENSP00000418803
Other Databases GeneCards:  TIMMDC1  Malacards:  TIMMDC1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005739 mitochondrion
IBA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0032981 mitochondrial respiratory
chain complex I assembly
TAS biological process
GO:0005739 mitochondrion
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0031966 mitochondrial membrane
IEA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005654 nucleoplasm
IDA cellular component
Associated diseases References
Mitochondrial complex I deficiency KEGG:H00473
Mitochondrial complex I deficiency KEGG:H00473
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract