• Gene id: 51299

Gene Summary

• Gene Symbol: NRN1   Gene   UCSC   Ensembl
• Aliases: NRN, dJ380B8.2
• Gene name: neuritin 1
• Alternate names: neuritin,
• Gene location: 6p25.1 (6007604: 5997998)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by n
• OMIM: 608336

Protein Summary

• Protein general information: Q9NPD7  
  • Name: Neuritin
  • Length: 142  
  • Mass: 15333
• Sequence:

  MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSC
  TVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPAFPVLLVSLSAALATWLSF

• Structural information:
  • Interpro: IPR026144  
  • STRING: ENSP00000480483
• Other Databases: GeneCards:  NRN1  Malacards:  NRN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007399	nervous system development	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray