• Gene id: 51297

Gene Summary

• Gene Symbol: BPIFA1   Gene   UCSC   Ensembl
• Aliases: LUNX, NASG, PLUNC, SPLUNC1, SPURT, bA49G10.5
• Gene name: BPI fold containing family A member 1
• Alternate names: BPI fold-containing family A member 1, ligand-binding protein RYA3, lung-specific protein X, nasopharyngeal carcinoma-related protein, palate lung and nasal epithelium clone protein, palate, lung and nasal epithelium associated, protein Plunc, secretory protein ,
• Gene location: 20q11.21 (33235995: 33243305)     Exons: 9     NC_000020.11
• Gene summary(Entrez): This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is tho
• OMIM: 190990

Protein Summary

• Protein general information: Q9NP55  
  • Name: BPI fold containing family A member 1 (Lung specific protein X) (Nasopharyngeal carcinoma related protein) (Palate lung and nasal epithelium clone protein) (Secretory protein in upper respiratory tracts) (Short PLUNC1) (SPLUNC1) (Tracheal epithelium enric
  • Length: 256  
  • Mass: 26713
  • Tissue specificity: Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level) (PubMed
• Sequence:

  MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLD
  ILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL
  LRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCP
  LVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

• Structural information:
  • Interpro: IPR017943  IPR034307  IPR017942  
  • PDB: 4KEG 4KGH 4KGO 4N4X 5I7J 5I7K 5I7L
  • PDBsum: 4KEG 4KGH 4KGO 4N4X 5I7J 5I7K 5I7L
  • STRING: ENSP00000346251
• Other Databases: GeneCards:  BPIFA1  Malacards:  BPIFA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1900229	negative regulation of single-species biofilm formation in or on host organism	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0050828	regulation of liquid surface tension	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0002395	immune response in nasopharyngeal-associated lymphoid tissue	IBA	biological process
GO:0050828	regulation of liquid surface tension	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:1902305	regulation of sodium ion transmembrane transport	IDA	biological process
GO:0050891	multicellular organismal water homeostasis	IDA	biological process
GO:1900229	negative regulation of single-species biofilm formation in or on host organism	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0050828	regulation of liquid surface tension	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0045087	innate immune response	NAS	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IEP	biological process
GO:0002395	immune response in nasopharyngeal-associated lymphoid tissue	IEP	biological process
GO:0051607	defense response to virus	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881