• Gene id: 51284

Gene Summary

• Gene Symbol: TLR7   Gene   UCSC   Ensembl
• Aliases: TLR7-like
• Gene name: toll like receptor 7
• Alternate names: toll-like receptor 7, toll-like receptor 7-like,
• Gene location: Xp22.2 (12867071: 12890360)     Exons: 3     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
• OMIM: 604607

Protein Summary

• Protein general information: Q9NYK1  
  • Name: Toll like receptor 7
  • Length: 1049  
  • Mass: 120922
  • Tissue specificity: Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells.
• Sequence:

  MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTIN
  HIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSL
  QLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPS
  TLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
  SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKIL
  RIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPSGDSSEVGFCSNART
  SVESYEPQVLEQLHYFRYDKYARSCRFKNKEASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLS
  GNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
  LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPP
  NLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLR
  YLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSV
  ISLDLYTCELDLTNLILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
  DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSH
  QRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

• Structural information:
  • Protein Domains: (889..103-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR026906  IPR032675   IPR000157  IPR026880  IPR035897  
  • Prosite: PS51450 PS50104
  • STRING: ENSP00000370034
• Other Databases: GeneCards:  TLR7  Malacards:  TLR7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IBA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IBA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IBA	biological process
GO:0032755	positive regulation of interleukin-6 production	IBA	biological process
GO:0038187	pattern recognition receptor activity	IBA	molecular function
GO:0034154	toll-like receptor 7 signaling pathway	IBA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0032009	early phagosome	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0003727	single-stranded RNA binding	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034154	toll-like receptor 7 signaling pathway	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0034154	toll-like receptor 7 signaling pathway	IEA	biological process
GO:0003727	single-stranded RNA binding	IEA	molecular function
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0001774	microglial cell activation	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045356	positive regulation of interferon-alpha biosynthetic process	IEA	biological process
GO:0035197	siRNA binding	IEA	molecular function
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032009	early phagosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0045359	positive regulation of interferon-beta biosynthetic process	IDA	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0045356	positive regulation of interferon-alpha biosynthetic process	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0003727	single-stranded RNA binding	ISS	molecular function
GO:0051607	defense response to virus	IMP	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IMP	biological process
GO:0035197	siRNA binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A
hsa05162	Measles
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881