• Gene id: 5128

Gene Summary

• Gene Symbol: CDK17   Gene   UCSC   Ensembl
• Aliases: PCTAIRE2, PCTK2
• Gene name: cyclin dependent kinase 17
• Alternate names: cyclin-dependent kinase 17, PCTAIRE-motif protein kinase 2, cell division protein kinase 17, protein kinase cdc2-related PCTAIRE-2, serine/threonine-protein kinase PCTAIRE-2,
• Gene location: 12q23.1 (96400438: 96278260)     Exons: 17     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to a rat protein that is thought to play a role in terminally differentiated neurons. Alternatively spliced transcript variants
• OMIM: 607509

Protein Summary

• Protein general information: Q00537  
  • Name: Cyclin dependent kinase 17 (EC 2.7.11.22) (Cell division protein kinase 17) (PCTAIRE motif protein kinase 2) (Serine/threonine protein kinase PCTAIRE 2)
  • Length: 523  
  • Mass: 59582
• Sequence:

  MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHS
  VIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPAD
  IRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRL
  EHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRG
  LAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGV
  GCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELI
  TKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

• Structural information:
  • Protein Domains: (192..47-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000261211
• Other Databases: GeneCards:  CDK17  Malacards:  CDK17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881