• Gene id: 51279

Gene Summary

• Gene Symbol: C1RL   Gene   UCSC   Ensembl
• Aliases: C1RL1, C1RLP, C1r-LP, CLSPa
• Gene name: complement C1r subcomponent like
• Alternate names: complement C1r subcomponent-like protein, C1r-like protein, C1r-like serine protease analog protein, complement C1r-like proteinase, complement component 1, r subcomponent-like,
• Gene location: 12p13.31 (7109213: 7094553)     Exons: 6     NC_000012.12

Protein Summary

• Protein general information: Q9NZP8  
  • Name: Complement C1r subcomponent like protein (C1r LP) (C1r like protein) (EC 3.4.21. ) (C1r like serine protease analog protein) (CLSPa)
  • Length: 487  
  • Mass: 53498
  • Tissue specificity: Highly expressed in placenta, liver, kidney, pancreas, moderately in lung, spleen, prostate, ovary, colon, and PBL, and weakly in heart, skeletal muscle, thymus, testis, and small intestine. Expressed in PC-3 (prostate adenocarcinoma)
• Sequence:

  MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEPYGKGQESSTDIKAPE
  GFAVRLVFQDFDLEPSQDCAGDSVTISFVGSDPSQFCGQQGSPLGRPPGQREFVSSGRSLRLTFRTQPSSENKTA
  HLHKGFLALYQTVAVNYSQPISEASRGSEAINAPGDNPAKVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEV
  LQCMPVCGRPVTPIAQNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVN
  VFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCLPDNETLYRSGLLGYV
  SGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQRHSVCQGDSGSVYVVWDNHAHHW
  VATGIVSWGIGCGEGYDFYTKVLSYVDWIKGVMNGKN

• Structural information:
  • Protein Domains: (39..16-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (245..48-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR000859  IPR009003  IPR001314  IPR035914  IPR035976   IPR001254  IPR033116  
  • Prosite: PS01180 PS50240 PS00135
  • CDD: cd00041 cd00190
  • STRING: ENSP00000266542
• Other Databases: GeneCards:  C1RL  Malacards:  C1RL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0031638	zymogen activation	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq