• Gene id: 51278

Gene Summary

• Gene Symbol: IER5   Gene   UCSC   Ensembl
• Aliases: SBBI48
• Gene name: immediate early response 5
• Alternate names: immediate early response gene 5 protein,
• Gene location: 1q25.3 (181088699: 181092899)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene
• OMIM: 607177

Protein Summary

• Protein general information: Q5VY09  
  • Name: Immediate early response gene 5 protein
  • Length: 327  
  • Mass: 33704
  • Tissue specificity: Expressed in acute myeloid leukemia (AML) cells. {ECO
• Sequence:

  MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGPAGTPAPPPQQQPGEP
  AAGPPAGWGEPPPPAARASWPETEPQPERSSVSDAPRVGDEVPVATVTGVGDVFQGGEADATEAAWSRVEGPRQA
  AAREAEGTAGGWGVFPEVSRAARRPCGCPLGGEDPPGTPAATPRAACCCAPQPAEDEPPAPPAVCPRKRCAAGVG
  GGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPE
  AAEPGQICCDKPVLRDMNPWSTAIVAF

• Structural information:
  • Interpro: IPR008653  
  • STRING: ENSP00000356549
• Other Databases: GeneCards:  IER5  Malacards:  IER5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034605	cellular response to heat	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000159	protein phosphatase type 2A complex	IDA	colocalizes with
GO:0042802	identical protein binding	IDA	molecular function
GO:0000159	protein phosphatase type 2A complex	IDA	colocalizes with
GO:1900036	positive regulation of cellular response to heat	IMP	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881