• Gene id: 51277

Gene Summary

• Gene Symbol: DNAJC27   Gene   UCSC   Ensembl
• Aliases: RBJ, RabJS
• Gene name: DnaJ heat shock protein family (Hsp40) member C27
• Alternate names: dnaJ homolog subfamily C member 27, DnaJ (Hsp40) homolog, subfamily C, member 27, Ras-associated protein Rap1, rab and DnaJ domain-containing protein,
• Gene location: 2p23.3 (24972093: 24943635)     Exons: 9     NC_000002.12
• OMIM: 613527

Protein Summary

• Protein general information: Q9NZQ0  
  • Name: DnaJ homolog subfamily C member 27 (Rab and DnaJ domain containing protein)
  • Length: 273  
  • Mass: 30855
  • Tissue specificity: Overexpressed in gastrointestinal cancers; expression correlates with later tumor-node-metastasis stages of colorectal cancers. {ECO
• Sequence:

  MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIFDMAGH
  PFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGR
  LWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIRRIRNSKDSWDMLGVK
  PGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK

• Structural information:
  • Protein Domains: (217..27-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR036869  IPR027417  IPR005225  IPR001806  
  • Prosite: PS50076 PS51419
  • CDD: cd06257
  • PDB: 2YS8
  • PDBsum: 2YS8
  • STRING: ENSP00000264711
• Other Databases: GeneCards:  DNAJC27  Malacards:  DNAJC27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0071701	regulation of MAPK export from nucleus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881