• Gene id: 51272

Gene Summary

• Gene Symbol: BET1L   Gene   UCSC   Ensembl
• Aliases: BET1L1, GOLIM3, GS15, HSPC197
• Gene name: Bet1 golgi vesicular membrane trafficking protein like
• Alternate names: BET1-like protein, GOS-15, blocked early in transport 1 homolog-like, golgi SNARE 15 kDa protein, golgi SNARE with a size of 15 kDa, golgi integral membrane protein 3, vesicle transport protein GOS15,
• Gene location: 11p15.5 (71724700: 71644923)     Exons: 20     NC_000016.10
• OMIM: 615417

Protein Summary

• Protein general information: Q9NYM9  
  • Name: BET1 like protein (Golgi SNARE with a size of 15 kDa) (GOS 15) (GS15) (Vesicle transport protein GOS15)
  • Length: 111  
  • Mass: 12388
• Sequence:

  MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFS
  TMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART

• Structural information:
  • Protein Domains: (15..7-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR039897  IPR039899  IPR000727  
  • Prosite: PS50192
  • CDD: cd15853
  • STRING: ENSP00000372210
• Other Databases: GeneCards:  BET1L  Malacards:  BET1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0031201	SNARE complex	TAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:2000156	regulation of retrograde vesicle-mediated transport, Golgi to ER	IBA	biological process
GO:0000138	Golgi trans cisterna	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0030173	integral component of Golgi membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0061025	membrane fusion	IEA	biological process
GO:0061025	membrane fusion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:2000156	regulation of retrograde vesicle-mediated transport, Golgi to ER	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
uterine fibroid	PMID:23892540
Endometrial adenocarcinoma	PMID:28654152
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881