• Gene id: 51271

Gene Summary

• Gene Symbol: UBAP1   Gene   UCSC   Ensembl
• Aliases: NAG20, SPG80, UAP, UBAP, UBAP-1
• Gene name: ubiquitin associated protein 1
• Alternate names: ubiquitin-associated protein 1, nasopharyngeal carcinoma-associated gene 20 protein,
• Gene location: 9p13.3 (34179004: 34252522)     Exons: 12     NC_000009.12
• Gene summary(Entrez): This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact
• OMIM: 609787

Protein Summary

• Protein general information: Q9NZ09  
  • Name: Ubiquitin associated protein 1 (UBAP 1) (Nasopharyngeal carcinoma associated gene 20 protein)
  • Length: 502  
  • Mass: 55084
  • Tissue specificity: Ubiquitous. Highly expressed in heart, brain, placenta, lung, liver, skeletal muscle and pancreas. {ECO
• Sequence:

  MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIKKIEEA
  EREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHI
  KADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQDEEVLASLERATLDF
  KPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQN
  SLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCTEESSPPNTGPTVTPPNFSVSQVPNM
  PSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHGQLCEKGFDPLLVEEALEMH
  QCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS

• Structural information:
  • Protein Domains: (17..6-)
    (/note="UMA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00830-)
    (389..43-)
    (/note="UBA-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (451..49-)
    (/note="UBA-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR015940  IPR009060  IPR038870  IPR042575  IPR023340  
  • Prosite: PS50030 PS51497
  • PDB: 1WGN 4AE4 5LM1
  • PDBsum: 1WGN 4AE4 5LM1
  • DIP: 47291
  • STRING: ENSP00000297661
• Other Databases: GeneCards:  UBAP1  Malacards:  UBAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IBA	biological process
GO:0000813	ESCRT I complex	IBA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0000813	ESCRT I complex	IEA	cellular component
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043657	host cell	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881